PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011077462.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 333aa    MW: 35063 Da    PI: 9.7213
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011077462.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.9e-3971130362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  XP_011077462.1  71 EAALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 130
                     7789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3454123IPR003851Zinc finger, Dof-type
PfamPF027017.2E-3373128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60974128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MVFSSIPAYL DPSNWHQNHQ IIGSSSSNPL LPPLAPPPPP PSQPHGGGGA GSIRPGSMSE  60
RARLANIPMP EAALKCPRCE STNTKFCYFN NYSLSQPRHF CKTCRRYWTR GGALRNVPVG  120
GGCRRNKRSK STSSKSPASN DRQTTSSSTS TISANSGGAN LLGLSPQLPP LRFTSPLSQL  180
TENFASDMGL NYSGISAAMA GTNEMNFHGV SSLLGGAGGM SSLLSSGGGA GGGIXTLAGW  240
RLQQMQQFPF LGGLDPSPLG IYQFQGGESG LVGSETTRPK LSSSLLTQMA SVKMEENPEL  300
NLSRQLLGND QWNATAAWTE LSSFSSSSTS NPL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077462.10.0PREDICTED: LOW QUALITY PROTEIN: dof zinc finger protein DOF5.1-like
TrEMBLA0A068UG681e-128A0A068UG68_COFCA; Uncharacterized protein
STRINGVIT_08s0007g00180.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-46DNA binding with one finger 2.4